Lineage for d1la6a_ (1la6 A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding protein
Protein Hemoglobin, alpha-chain [46486] (24 species) Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (7 PDB entries) 
Domain d1la6a_: 1la6 A: [73782]
Other proteins in same PDB: d1la6b_
complexed with cmo, hem
Details for d1la6a_
PDB Entry: 1la6 (more details), 2 Å
PDB Description: The crystal structure of Trematomus newnesi hemoglobin in a partial hemichrome state
PDB Compounds: (A:) Hemoglobin alpha-1 chainSCOPe Domain Sequences for d1la6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1la6a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr
SCOPe Domain Coordinates for d1la6a_:
Click to download the PDB-style file with coordinates for d1la6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1la6a_:
- d1la6a_ first appeared in SCOP 1.61
- d1la6a_ appears in SCOPe 2.07
View in 3D
