SCOP 1.61: Domain d1la6a_: 1la6 A:

Lineage for d1la6a_ (1la6 A:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, alpha-chain [46486] (16 species)

7. Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (2 PDB entries)

8. Domain d1la6a_: 1la6 A: [73782]
   Other proteins in same PDB: d1la6b_

Details for d1la6a_

PDB Entry: 1la6, 2 Å

PDB Description: The crystal structure of Trematomus newnesi hemoglobin in a partial hemichrome state

SCOP Domain Sequences for d1la6a_:

Sequence; same for both SEQRES and ATOM records:

>d1la6a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi)}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

Timeline for d1la6a_:

• d1la6a_ is new in SCOP 1.61
  
• d1la6a_ appears in SCOP 1.63
  
• d1la6a_ appears in the current release, SCOPe 2.08