Lineage for d1kepb_ (1kep B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
has additional subdomain(s) that are not in the common domain
Protein dTDP-glucose 4,6-dehydratase (RmlB) [51755] (4 species) 
Species Streptococcus suis, serotype 2 [TaxId:1307] [69406] (6 PDB entries) 
Domain d1kepb_: 1kep B: [68537]
complexed with nad, so4, tdx
has additional subdomain(s) that are not in the common domain
Details for d1kepb_
PDB Entry: 1kep (more details), 1.8 Å
PDB Description: the crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound
PDB Compounds: (B:) dtdp-d-glucose 4,6-dehydrataseSCOPe Domain Sequences for d1kepb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kepb_ c.2.1.2 (B:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]}
sqfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvvg
diadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirfh
hvstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfgv
katisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwail
tkgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrde
lgwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevi
SCOPe Domain Coordinates for d1kepb_:
Click to download the PDB-style file with coordinates for d1kepb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kepb_:
- d1kepb_ first appeared in SCOP 1.59
- d1kepb_ appears in SCOPe 2.07
View in 3D
