Lineage for d1kepb_ (1kep B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842012Protein dTDP-glucose 4,6-dehydratase (RmlB) [51755] (4 species)
  7. 2842021Species Streptococcus suis, serotype 2 [TaxId:1307] [69406] (6 PDB entries)
  8. 2842033Domain d1kepb_: 1kep B: [68537]
    complexed with nad, so4, tdx
    has additional subdomain(s) that are not in the common domain

Details for d1kepb_

PDB Entry: 1kep (more details), 1.8 Å

PDB Description: the crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound
PDB Compounds: (B:) dtdp-d-glucose 4,6-dehydratase

SCOPe Domain Sequences for d1kepb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kepb_ c.2.1.2 (B:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]}
sqfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvvg
diadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirfh
hvstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfgv
katisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwail
tkgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrde
lgwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevi

SCOPe Domain Coordinates for d1kepb_:

Click to download the PDB-style file with coordinates for d1kepb_.
(The format of our PDB-style files is described here.)

Timeline for d1kepb_: