Lineage for d1jwhd_ (1jwh D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036480Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) (S)
    automatically mapped to Pfam PF01214
  5. 3036481Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
    contains alpha-helices in the N- and C-terminal extensions (linkers?)
  6. 3036482Protein Casein kinase II beta subunit [57800] (3 species)
  7. 3036492Species Human (Homo sapiens) [TaxId:9606] [57801] (5 PDB entries)
  8. 3036504Domain d1jwhd_: 1jwh D: [71916]
    Other proteins in same PDB: d1jwha_, d1jwhb_
    complexed with anp, po4, zn

Details for d1jwhd_

PDB Entry: 1jwh (more details), 3.1 Å

PDB Description: Crystal Structure of Human Protein Kinase CK2 Holoenzyme
PDB Compounds: (D:) Casein kinase II beta chain

SCOPe Domain Sequences for d1jwhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwhd_ g.41.4.1 (D:) Casein kinase II beta subunit {Human (Homo sapiens) [TaxId: 9606]}
ssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdee
lednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlp
iglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpan
qfvprlygfkihpmayqlqlqaas

SCOPe Domain Coordinates for d1jwhd_:

Click to download the PDB-style file with coordinates for d1jwhd_.
(The format of our PDB-style files is described here.)

Timeline for d1jwhd_: