PDB entry 1jwh

View 1jwh on RCSB PDB site
Description: Crystal Structure of Human Protein Kinase CK2 Holoenzyme
Class: transferase
Keywords: casein kinase 2, CK2 holoenzyme, protein kinase CK2, TRANSFERASE
Deposited on 2001-09-04, released 2002-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.267
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase II, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jwha_
  • Chain 'B':
    Compound: casein kinase II, alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jwhb_
  • Chain 'C':
    Compound: Casein kinase II beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jwhc_
  • Chain 'D':
    Compound: Casein kinase II beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jwhd_
  • Heterogens: PO4, ZN, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jwhA (A:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarmgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwhA (A:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqarmgss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jwhB (B:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvkdqarmgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwhB (B:)
    sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
    nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
    kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
    yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
    lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
    dkllrydhqsrltareamehpyfytvvkdqarmgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jwhC (C:)
    mssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepde
    elednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpml
    piglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpa
    nqfvprlygfkihpmayqlqlqaasnfkspvktir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwhC (C:)
    evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeeledn
    pnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpigls
    dipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvp
    rlygfkihpmayqlqlqaas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jwhD (D:)
    mssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepde
    elednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpml
    piglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpa
    nqfvprlygfkihpmayqlqlqaasnfkspvktir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jwhD (D:)
    ssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdee
    lednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlp
    iglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpan
    qfvprlygfkihpmayqlqlqaas