Lineage for d1jqpa2 (1jqp A:204-438)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1888976Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1889156Protein Cathepsin C (dipeptidyl peptidase I), catalytic domain [75330] (2 species)
  7. 1889159Species Norway rat (Rattus norvegicus) [TaxId:10116] [82565] (1 PDB entry)
  8. 1889160Domain d1jqpa2: 1jqp A:204-438 [77163]
    Other proteins in same PDB: d1jqpa1
    complexed with cl, nag, so4

Details for d1jqpa2

PDB Entry: 1jqp (more details), 2.4 Å

PDB Description: dipeptidyl peptidase i (cathepsin c), a tetrameric cysteine protease of the papain family
PDB Compounds: (A:) dipeptidyl peptidase I

SCOPe Domain Sequences for d1jqpa2:

Sequence, based on SEQRES records: (download)

>d1jqpa2 d.3.1.1 (A:204-438) Cathepsin C (dipeptidyl peptidase I), catalytic domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lslpeswdwrnvrginfvspvrnqescgscysfaslgmleaririltnnsqtpilspqev
vscspyaqgcdggfpyliagkyaqdfgvveencfpytatdapckpkenclryysseyyyv
ggfyggcnealmklelvkhgpmavafevhddflhyhsgiyhhtglsdpfnpfeltnhavl
lvgygkdpvtgldywivknswgsqwgesgyfrirrgtdecaiesiamaaipipkl

Sequence, based on observed residues (ATOM records): (download)

>d1jqpa2 d.3.1.1 (A:204-438) Cathepsin C (dipeptidyl peptidase I), catalytic domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lslpeswdwrnvrginfvspvrnqescgscysfaslgmleaririltnnsqtpilspqev
vscspyaqgcdggfpyliagkyaqdfgvveencfpytatdapckpkenclryysseyyyv
ggfyggcnealmklelvkhgpmavafevhddflhyhsgiyhhpfnpfeltnhavllvgyg
kdpvtgldywivknswgsqwgesgyfrirrgtdecaiesiamaaipipkl

SCOPe Domain Coordinates for d1jqpa2:

Click to download the PDB-style file with coordinates for d1jqpa2.
(The format of our PDB-style files is described here.)

Timeline for d1jqpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jqpa1