SCOPe 2.05: Domain d1jqpa1: 1jqp A:1-118

Lineage for d1jqpa1 (1jqp A:1-118)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families)
   automatically mapped to Pfam PF08773

5. Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein)

6. Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [82160] (1 PDB entry)

8. Domain d1jqpa1: 1jqp A:1-118 [77162]
   Other proteins in same PDB: d1jqpa2
   complexed with cl, nag, so4

Details for d1jqpa1

PDB Entry: 1jqp, 2.4 Å

PDB Description: dipeptidyl peptidase i (cathepsin c), a tetrameric cysteine protease of the papain family

PDB Compounds: (A:) dipeptidyl peptidase I

SCOPe Domain Sequences for d1jqpa1:

Sequence; same for both SEQRES and ATOM records:

>d1jqpa1 b.61.5.1 (A:1-118) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtpanctypdllgtwvfqvgprhprshincsvmepteekvvihlkkldtaydevgnsgyf
tliynqgfeivlndykwfaffkyevkgsraisychetmtgwvhdvlgrnwacfvgkkm

Timeline for d1jqpa1:

• d1jqpa1 first appeared in SCOP 1.63
  
• d1jqpa1 appears in SCOPe 2.04
  
• d1jqpa1 appears in SCOPe 2.06
  
• d1jqpa1 appears in the current release, SCOPe 2.08