Class b: All beta proteins [48724] (176 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) automatically mapped to Pfam PF08773 |
Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein) |
Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [82160] (1 PDB entry) |
Domain d1jqpa1: 1jqp A:1-118 [77162] Other proteins in same PDB: d1jqpa2 complexed with cl, nag, so4 |
PDB Entry: 1jqp (more details), 2.4 Å
SCOPe Domain Sequences for d1jqpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jqpa1 b.61.5.1 (A:1-118) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} dtpanctypdllgtwvfqvgprhprshincsvmepteekvvihlkkldtaydevgnsgyf tliynqgfeivlndykwfaffkyevkgsraisychetmtgwvhdvlgrnwacfvgkkm
Timeline for d1jqpa1: