![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein Cathepsin C (dipeptidyl peptidase I), catalytic domain [75330] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [82565] (1 PDB entry) |
![]() | Domain d1jqpa2: 1jqp A:204-438 [77163] Other proteins in same PDB: d1jqpa1 complexed with cl, nag, so4 |
PDB Entry: 1jqp (more details), 2.4 Å
SCOPe Domain Sequences for d1jqpa2:
Sequence, based on SEQRES records: (download)
>d1jqpa2 d.3.1.1 (A:204-438) Cathepsin C (dipeptidyl peptidase I), catalytic domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} lslpeswdwrnvrginfvspvrnqescgscysfaslgmleaririltnnsqtpilspqev vscspyaqgcdggfpyliagkyaqdfgvveencfpytatdapckpkenclryysseyyyv ggfyggcnealmklelvkhgpmavafevhddflhyhsgiyhhtglsdpfnpfeltnhavl lvgygkdpvtgldywivknswgsqwgesgyfrirrgtdecaiesiamaaipipkl
>d1jqpa2 d.3.1.1 (A:204-438) Cathepsin C (dipeptidyl peptidase I), catalytic domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} lslpeswdwrnvrginfvspvrnqescgscysfaslgmleaririltnnsqtpilspqev vscspyaqgcdggfpyliagkyaqdfgvveencfpytatdapckpkenclryysseyyyv ggfyggcnealmklelvkhgpmavafevhddflhyhsgiyhhpfnpfeltnhavllvgyg kdpvtgldywivknswgsqwgesgyfrirrgtdecaiesiamaaipipkl
Timeline for d1jqpa2: