Lineage for d1jmab2 (1jma B:60-105)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639374Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2639375Protein Cellular receptor HveA [64568] (1 species)
  7. 2639376Species Human (Homo sapiens) [TaxId:9606] [64569] (2 PDB entries)
  8. 2639378Domain d1jmab2: 1jma B:60-105 [63179]
    Other proteins in same PDB: d1jmaa_
    complexed with so4

Details for d1jmab2

PDB Entry: 1jma (more details), 2.65 Å

PDB Description: crystal structure of the herpes simplex virus glycoprotein d bound to the cellular receptor hvea/hvem
PDB Compounds: (B:) herpesvirus entry mediator

SCOPe Domain Sequences for d1jmab2:

Sequence, based on SEQRES records: (download)

>d1jmab2 g.24.1.1 (B:60-105) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacrayat

Sequence, based on observed residues (ATOM records): (download)

>d1jmab2 g.24.1.1 (B:60-105) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdhcaacrayat

SCOPe Domain Coordinates for d1jmab2:

Click to download the PDB-style file with coordinates for d1jmab2.
(The format of our PDB-style files is described here.)

Timeline for d1jmab2:

2639378
d1jmab2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1jmab1
2639378
d1jmab2 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1jmaa_