![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
![]() | Superfamily g.24.1: TNF receptor-like [57586] (3 families) ![]() |
![]() | Family g.24.1.1: TNF receptor-like [57587] (6 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
![]() | Protein Cellular receptor HveA [64568] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64569] (2 PDB entries) |
![]() | Domain d1jmab1: 1jma B:4-59 [63178] Other proteins in same PDB: d1jmaa_ complexed with so4 |
PDB Entry: 1jma (more details), 2.65 Å
SCOPe Domain Sequences for d1jmab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmab1 g.24.1.1 (B:4-59) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]} ckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq
Timeline for d1jmab1: