Class g: Small proteins [56992] (100 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
Protein bard1 RING domain [69970] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69971] (1 PDB entry) |
Domain d1jm7b_: 1jm7 B: [66881] Other proteins in same PDB: d1jm7a_ heterodimer with brca1 RING domain complexed with zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1jm7 (more details)
SCOPe Domain Sequences for d1jm7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} mepdgrgawahsraaldrlekllrcsrctnilrepvclggcehifcsncvsdcigtgcpv cytpawiqdlkinrqldsmiqlcsklrnllhdnelsd
Timeline for d1jm7b_: