SCOPe 2.08: Domain d1jm7a_: 1jm7 A:

Lineage for d1jm7a_ (1jm7 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein brca1 RING domain [69968] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69969] (1 PDB entry)

8. Domain d1jm7a_: 1jm7 A: [66880]
   Other proteins in same PDB: d1jm7b_
   heterodimer with bard1 RING domain
   complexed with zn
   has additional insertions and/or extensions that are not grouped together

Details for d1jm7a_

PDB Entry: 1jm7

PDB Description: solution structure of the brca1/bard1 ring-domain heterodimer

PDB Compounds: (A:) breast cancer type 1 susceptibility protein

SCOPe Domain Sequences for d1jm7a_:

Sequence; same for both SEQRES and ATOM records:

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}
mdlsalrveevqnvinamqkilecpiclelikepvstkcdhifckfcmlkllnqkkgpsq
cplcknditkrslqestrfsqlveellkiicafqldtgleyan

Timeline for d1jm7a_:

• d1jm7a_ first appeared in SCOP 1.59
  
• d1jm7a_ appears in SCOPe 2.07