PDB entry 1jm7

View 1jm7 on RCSB PDB site
Description: Solution structure of the BRCA1/BARD1 RING-domain heterodimer
Class: antitumor
Keywords: BRCA1, BARD1, RING finger, zinc-binding protein, heterodimer, ubiquitin ligase, ANTITUMOR
Deposited on 2001-07-17, released 2001-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: breast cancer type 1 susceptibility protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRCA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jm7a_
  • Chain 'B':
    Compound: brca1-associated ring domain protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BARD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jm7b_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jm7A (A:)
    mdlsalrveevqnvinamqkilecpiclelikepvstkcdhifckfcmlkllnqkkgpsq
    cplcknditkrslqestrfsqlveellkiicafqldtgleyansynfakkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jm7A (A:)
    mdlsalrveevqnvinamqkilecpiclelikepvstkcdhifckfcmlkllnqkkgpsq
    cplcknditkrslqestrfsqlveellkiicafqldtgleyan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jm7B (B:)
    mepdgrgawahsraaldrlekllrcsrctnilrepvclggcehifcsncvsdcigtgcpv
    cytpawiqdlkinrqldsmiqlcsklrnllhdnelsdlkedkprkslfndagnkkgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jm7B (B:)
    mepdgrgawahsraaldrlekllrcsrctnilrepvclggcehifcsncvsdcigtgcpv
    cytpawiqdlkinrqldsmiqlcsklrnllhdnelsd