Lineage for d1jffb2 (1jff B:246-437)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) 
Protein Tubulin beta-subunit [55313] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [64322] (5 PDB entries)
Uniprot P02554
Domain d1jffb2: 1jff B:246-437 [62935]
Other proteins in same PDB: d1jffa1, d1jffa2, d1jffb1
complexed with gdp, gtp, mg, ta1, zn
Details for d1jffb2
PDB Entry: 1jff (more details), 3.5 Å
PDB Description: refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol
PDB Compounds: (B:) Tubulin beta chainSCOPe Domain Sequences for d1jffb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jffb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd
SCOPe Domain Coordinates for d1jffb2:
Click to download the PDB-style file with coordinates for d1jffb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jffb2:
- d1jffb2 first appeared in SCOP 1.57
- d1jffb2 appears in SCOPe 2.02
- d1jffb2 appears in SCOPe 2.04
- d1jffb2 appears in the current release, SCOPe 2.08
View in 3D
