Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Tubulin beta-subunit [55313] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [64322] (5 PDB entries) Uniprot P02554 |
Domain d1jffb2: 1jff B:246-437 [62935] Other proteins in same PDB: d1jffa1, d1jffa2, d1jffb1 complexed with gdp, gtp, mg, ta1, zn |
PDB Entry: 1jff (more details), 3.5 Å
SCOPe Domain Sequences for d1jffb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jffb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqd
Timeline for d1jffb2: