Lineage for d1jffb1 (1jff B:2-245)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361112Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1361113Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1361114Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1361207Protein Tubulin beta-subunit [52496] (2 species)
  7. 1361208Species Cow (Bos taurus) [TaxId:9913] [63990] (5 PDB entries)
    Uniprot P02550 ! Uniprot P02554
  8. 1361209Domain d1jffb1: 1jff B:2-245 [62934]
    Other proteins in same PDB: d1jffa1, d1jffa2, d1jffb2
    complexed with gdp, gtp, mg, ta1, zn

Details for d1jffb1

PDB Entry: 1jff (more details), 3.5 Å

PDB Description: refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d1jffb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jffb1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d1jffb1:

Click to download the PDB-style file with coordinates for d1jffb1.
(The format of our PDB-style files is described here.)

Timeline for d1jffb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jffb2