Lineage for d1jffb2 (1jff B:246-437)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209532Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1209762Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family) (S)
  5. 1209763Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 1209820Protein Tubulin beta-subunit [55313] (2 species)
  7. 1209821Species Cow (Bos taurus) [TaxId:9913] [64322] (5 PDB entries)
    Uniprot P02554
  8. 1209822Domain d1jffb2: 1jff B:246-437 [62935]
    Other proteins in same PDB: d1jffa1, d1jffa2, d1jffb1
    complexed with gdp, gtp, mg, ta1, zn

Details for d1jffb2

PDB Entry: 1jff (more details), 3.5 Å

PDB Description: refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d1jffb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jffb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd

SCOPe Domain Coordinates for d1jffb2:

Click to download the PDB-style file with coordinates for d1jffb2.
(The format of our PDB-style files is described here.)

Timeline for d1jffb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jffb1