Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) |
Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins) |
Protein Tubulin beta-subunit [52496] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [63990] (5 PDB entries) Uniprot P02550 ! Uniprot P02554 |
Domain d1jffb1: 1jff B:2-245 [62934] Other proteins in same PDB: d1jffa1, d1jffa2, d1jffb2 complexed with gdp, gtp, mg, ta1, zn |
PDB Entry: 1jff (more details), 3.5 Å
SCOPe Domain Sequences for d1jffb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jffb1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr fp
Timeline for d1jffb1: