SCOPe 2.02: Domain d1jffb1: 1jff B:2-245

Lineage for d1jffb1 (1jff B:2-245)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family)

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)

6. Protein Tubulin beta-subunit [52496] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [63990] (5 PDB entries)
   Uniprot P02550 ! Uniprot P02554

8. Domain d1jffb1: 1jff B:2-245 [62934]
   Other proteins in same PDB: d1jffa1, d1jffa2, d1jffb2
   complexed with gdp, gtp, mg, ta1, zn

Details for d1jffb1

PDB Entry: 1jff, 3.5 Å

PDB Description: refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d1jffb1:

Sequence; same for both SEQRES and ATOM records:

>d1jffb1 c.32.1.1 (B:2-245) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d1jffb1:

• d1jffb1 first appeared in SCOP 1.57
  
• d1jffb1 appears in SCOPe 2.01
  
• d1jffb1 appears in SCOPe 2.03
  
• d1jffb1 appears in the current release, SCOPe 2.08