Lineage for d1igla_ (1igl A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2256769Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2256770Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2256771Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2256992Protein Insulin-like growth factor [57002] (1 species)
  7. 2256993Species Human (Homo sapiens) [TaxId:9606] [57003] (22 PDB entries)
    Uniprot P05019 49-110
  8. 2257013Domain d1igla_: 1igl A: [43993]

Details for d1igla_

PDB Entry: 1igl (more details)

PDB Description: solution structure of human insulin-like growth factor ii relationship to receptor and binding protein interactions
PDB Compounds: (A:) insulin-like growth factor II

SCOPe Domain Sequences for d1igla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igla_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse

SCOPe Domain Coordinates for d1igla_:

Click to download the PDB-style file with coordinates for d1igla_.
(The format of our PDB-style files is described here.)

Timeline for d1igla_: