SCOPe 2.07: Domain d1igla_: 1igl A:

Lineage for d1igla_ (1igl A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
   Uniprot P05019 49-110

8. Domain d1igla_: 1igl A: [43993]

Details for d1igla_

PDB Entry: 1igl

PDB Description: solution structure of human insulin-like growth factor ii relationship to receptor and binding protein interactions

PDB Compounds: (A:) insulin-like growth factor II

SCOPe Domain Sequences for d1igla_:

Sequence; same for both SEQRES and ATOM records:

>d1igla_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse

Timeline for d1igla_:

• d1igla_ first appeared (with stable ids) in SCOP 1.55, called d1igl__
  
• d1igla_ appears in SCOPe 2.06
  
• d1igla_ appears in the current release, SCOPe 2.08