Lineage for d1igl__ (1igl -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39386Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 39387Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 39388Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 39556Protein Insulin-like growth factor [57002] (1 species)
  7. 39557Species Human (Homo sapiens) [TaxId:9606] [57003] (6 PDB entries)
  8. 39560Domain d1igl__: 1igl - [43993]

Details for d1igl__

PDB Entry: 1igl (more details)

PDB Description: solution structure of human insulin-like growth factor ii relationship to receptor and binding protein interactions

SCOP Domain Sequences for d1igl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igl__ g.1.1.1 (-) Insulin-like growth factor {Human (Homo sapiens)}
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse

SCOP Domain Coordinates for d1igl__:

Click to download the PDB-style file with coordinates for d1igl__.
(The format of our PDB-style files is described here.)

Timeline for d1igl__: