Lineage for d1hrja_ (1hrj A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies)
beta(3)-alpha
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) 
form dimers with different dimerisation modesFamily d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) 
Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
has different dimerisation modeSpecies Human (Homo sapiens) [TaxId:9606] [54133] (10 PDB entries)
Uniprot P13501 25-91
Domain d1hrja_: 1hrj A: [37418]
Details for d1hrja_
PDB Entry: 1hrj (more details)
PDB Description: human rantes, nmr, 13 structures
PDB Compounds: (A:) human regulated upon activation normal T-cell expressed and secretedSCOPe Domain Sequences for d1hrja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hrja_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
yinslems
SCOPe Domain Coordinates for d1hrja_:
Click to download the PDB-style file with coordinates for d1hrja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hrja_:
- d1hrja_ first appeared (with stable ids) in SCOP 1.55
- d1hrja_ appears in SCOPe 2.03
- d1hrja_ appears in SCOPe 2.05
- d1hrja_ appears in the current release, SCOPe 2.08
View in 3D
