![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.9: IL8-like [54116] (2 superfamilies) |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins) |
![]() | Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54133] (5 PDB entries) |
![]() | Domain d1hrja_: 1hrj A: [37418] |
PDB Entry: 1hrj (more details)
SCOP Domain Sequences for d1hrja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hrja_ d.9.1.1 (A:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens)} spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre yinslems
Timeline for d1hrja_: