PDB entry 1hrj

View 1hrj on RCSB PDB site
Description: human rantes, nmr, 13 structures
Class: cytokine (chemotactic)
Keywords: cc chemokine, cytokine (chemotactic)
Deposited on 1995-08-18, released 1996-10-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human regulated upon activation normal T-cell expressed and secreted
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hrja_
  • Chain 'B':
    Compound: human regulated upon activation normal T-cell expressed and secreted
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1hrjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrjA (A:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrjB (B:)
    spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
    yinslems