Lineage for d1haua1 (1hau A:1-159)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding siteFamily b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) 
Species Alcaligenes xylosoxidans [TaxId:85698] [419328] (24 PDB entries)
Uniprot O68601
Domain d1haua1: 1hau A:1-159 [60879]
Other proteins in same PDB: d1haua2
complexed with cu
Details for d1haua1
PDB Entry: 1hau (more details), 1.9 Å
PDB Description: x-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductaseSCOPe Domain Sequences for d1haua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1haua1 b.6.1.3 (A:1-159) Nitrite reductase, NIR, N-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]}
qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp
SCOPe Domain Coordinates for d1haua1:
Click to download the PDB-style file with coordinates for d1haua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1haua1:
- d1haua1 first appeared in SCOP 1.57
- d1haua1 appears in SCOPe 2.07
View in 3D
