![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (24 PDB entries) Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601 |
![]() | Domain d1haua1: 1hau A:1-159 [60879] complexed with cu |
PDB Entry: 1hau (more details), 1.9 Å
SCOPe Domain Sequences for d1haua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1haua1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp
Timeline for d1haua1: