Lineage for d1haua1 (1hau A:1-159)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56191Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 56231Protein Nitrite reductase, NIR [49551] (3 species)
  7. 56318Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (6 PDB entries)
  8. 56319Domain d1haua1: 1hau A:1-159 [60879]

Details for d1haua1

PDB Entry: 1hau (more details), 1.9 Å

PDB Description: x-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution

SCOP Domain Sequences for d1haua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1haua1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

SCOP Domain Coordinates for d1haua1:

Click to download the PDB-style file with coordinates for d1haua1.
(The format of our PDB-style files is described here.)

Timeline for d1haua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1haua2