Lineage for d1gata_ (1gat A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035588Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
    single zinc-binding motif
  6. 3035589Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [57719] (4 PDB entries)
  8. 3035593Domain d1gata_: 1gat A: [45106]
    protein/DNA complex; complexed with zn

Details for d1gata_

PDB Entry: 1gat (more details)

PDB Description: solution structure of the specific dna complex of the zinc containing dna binding domain of the erythroid transcription factor gata-1 by multidimensional nmr
PDB Compounds: (A:) erythroid transcription factor gata-1

SCOPe Domain Sequences for d1gata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]}
kragtvcsncqtstttlwrrspmgdpvcnacglyyklhqvnrpltmrkdgiqtrnrkvss

SCOPe Domain Coordinates for d1gata_:

Click to download the PDB-style file with coordinates for d1gata_.
(The format of our PDB-style files is described here.)

Timeline for d1gata_: