![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins) single zinc-binding motif |
![]() | Protein Erythroid transcription factor GATA-1 [57718] (3 species) |
![]() | Domain d1gata_: 1gat A: [45106] protein/DNA complex; complexed with zn |
PDB Entry: 1gat (more details)
SCOPe Domain Sequences for d1gata_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} kragtvcsncqtstttlwrrspmgdpvcnacglyyklhqvnrpltmrkdgiqtrnrkvss
Timeline for d1gata_: