SCOP 1.55: Domain d1gata_: 1gat A:

Lineage for d1gata_ (1gat A:)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families)

5. Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (1 protein)

6. Protein Erythroid transcription factor GATA-1 [57718] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [57719] (8 PDB entries)

8. Domain d1gata_: 1gat A: [45106]

Details for d1gata_

PDB Entry: 1gat

PDB Description: solution structure of the specific dna complex of the zinc containing dna binding domain of the erythroid transcription factor gata-1 by multidimensional nmr

SCOP Domain Sequences for d1gata_:

Sequence; same for both SEQRES and ATOM records:

>d1gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus)}
kragtvcsncqtstttlwrrspmgdpvcnacglyyklhqvnrpltmrkdgiqtrnrkvss

Timeline for d1gata_:

• d1gata_ appears in SCOP 1.57
  
• d1gata_ appears in the current release, SCOPe 2.08