Lineage for d1g7oa2 (1g7o A:1-75)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) 
Protein Glutaredoxin 2 [64060] (1 species)
similar to class zeta enzymesSpecies Escherichia coli [TaxId:562] [64061] (1 PDB entry) 
Domain d1g7oa2: 1g7o A:1-75 [60333]
Other proteins in same PDB: d1g7oa1
Details for d1g7oa2
PDB Entry: 1g7o (more details)
PDB Description: nmr solution structure of reduced e. coli glutaredoxin 2
PDB Compounds: (A:) glutaredoxin 2SCOPe Domain Sequences for d1g7oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}
mklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp
esmdivhyvdkldgk
SCOPe Domain Coordinates for d1g7oa2:
Click to download the PDB-style file with coordinates for d1g7oa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g7oa2:
- d1g7oa2 first appeared in SCOP 1.57
- d1g7oa2 appears in SCOPe 2.06
- d1g7oa2 appears in the current release, SCOPe 2.08
View in 3D
