Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Glutaredoxin 2 [64060] (1 species) similar to class zeta enzymes |
Species Escherichia coli [TaxId:562] [64061] (1 PDB entry) |
Domain d1g7oa2: 1g7o A:1-75 [60333] Other proteins in same PDB: d1g7oa1 |
PDB Entry: 1g7o (more details)
SCOPe Domain Sequences for d1g7oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} mklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp esmdivhyvdkldgk
Timeline for d1g7oa2: