| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Glutaredoxin 2 [63557] (1 species) similar to class zeta enzymes |
| Species Escherichia coli [TaxId:562] [63558] (1 PDB entry) |
| Domain d1g7oa1: 1g7o A:76-215 [60332] Other proteins in same PDB: d1g7oa2 |
PDB Entry: 1g7o (more details)
SCOPe Domain Sequences for d1g7oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}
plltgkrspaieewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad
llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva
dyrdnmakqtqinllssmai
Timeline for d1g7oa1: