![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) ![]() |
![]() | Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein) |
![]() | Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [48166] (11 PDB entries) |
![]() | Domain d1g59a1: 1g59 A:306-468 [60257] Other proteins in same PDB: d1g59a2, d1g59c2 protein/RNA complex |
PDB Entry: 1g59 (more details), 2.4 Å
SCOPe Domain Sequences for d1g59a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g59a1 a.97.1.1 (A:306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv klgqvaqplraaltgsletpglfeilallgkeralrrlerala
Timeline for d1g59a1: