![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
![]() | Protein Glutamyl-tRNA synthetase (GluRS) [52382] (1 species) Catalytic domain is very similar to that of GlnRS |
![]() | Species Thermus thermophilus [TaxId:274] [52383] (11 PDB entries) |
![]() | Domain d1g59a2: 1g59 A:1-305 [60258] Other proteins in same PDB: d1g59a1, d1g59c1 protein/RNA complex |
PDB Entry: 1g59 (more details), 2.4 Å
SCOPe Domain Sequences for d1g59a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g59a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal kwlglsydegpdvaaptgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl ggpvf
Timeline for d1g59a2: