PDB entry 1g59

View 1g59 on RCSB PDB site
Description: glutamyl-tRNA synthetase complexed with tRNA(glu).
Class: ligase/RNA
Keywords: aminoacyl-tRNA synthetase, protein-RNA complex, transfer RNA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LIGASE/RNA COMPLEX
Deposited on 2000-10-31, released 2001-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g59a1, d1g59a2
  • Chain 'B':
    Compound: tRNA(glu)
  • Chain 'C':
    Compound: Glutamyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g59c1, d1g59c2
  • Chain 'D':
    Compound: tRNA(glu)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g59A (A:)
    mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
    kwlglsydegpdvaaptgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
    gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
    sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
    ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
    ggpvfdleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfd
    tlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfa
    aekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g59C (C:)
    mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
    kwlglsydegpdvaaptgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
    gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
    sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
    ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
    ggpvfdleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfd
    tlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfa
    aekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
    

  • Chain 'D':
    No sequence available.