Lineage for d1e42a2 (1e42 A:825-937)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheetSuperfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) 
Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins) 
Protein Beta2-adaptin AP2, C-terminal subdomain [55715] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55716] (4 PDB entries) 
Domain d1e42a2: 1e42 A:825-937 [40792]
Other proteins in same PDB: d1e42a1, d1e42b1
Details for d1e42a2
PDB Entry: 1e42 (more details), 1.7 Å
PDB Description: beta2-adaptin appendage domain, from clathrin adaptor ap2
PDB Compounds: (A:) beta2-adaptinSCOP Domain Sequences for d1e42a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e42a2 d.105.1.1 (A:825-937) Beta2-adaptin AP2, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn
SCOP Domain Coordinates for d1e42a2:
Click to download the PDB-style file with coordinates for d1e42a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e42a2:
- d1e42a2 first appeared (with stable ids) in SCOP 1.55
- d1e42a2 appears in SCOP 1.71
- d1e42a2 appears in SCOP 1.75
- d1e42a2 appears in the current release, SCOPe 2.08
View in 3D
