PDB entry 1e42

View 1e42 on RCSB PDB site
Description: beta2-adaptin appendage domain, from clathrin adaptor ap2
Class: endocytosis
Keywords: endocytosis, adaptor
Deposited on 2000-06-27, released 2000-08-21
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta2-adaptin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1e42a1, d1e42a2
  • Chain 'B':
    Compound: beta2-adaptin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1e42b1, d1e42b2
  • Heterogens: CL, MG, NI, DTD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e42A (A:)
    mgsshhhhhhssglvprgshmgmapggyvapkavwlpavkakgleisgtfthrqghiyme
    mnftnkalqhmtdfaiqfnknsfgvipstplaihtplmpnqsidvslplntlgpvmkmep
    lnnlqvavknnidvfyfscliplnvlfvedgkmerqvflatwkdipnenelqfqikechl
    nadtvssklqnnnvytiakrnvegqdmlyqslkltngiwilaelriqpgnpnytlslkcr
    apevsqyiyqvydsilkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e42A (A:)
    ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
    ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv
    lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
    dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e42B (B:)
    mgsshhhhhhssglvprgshmgmapggyvapkavwlpavkakgleisgtfthrqghiyme
    mnftnkalqhmtdfaiqfnknsfgvipstplaihtplmpnqsidvslplntlgpvmkmep
    lnnlqvavknnidvfyfscliplnvlfvedgkmerqvflatwkdipnenelqfqikechl
    nadtvssklqnnnvytiakrnvegqdmlyqslkltngiwilaelriqpgnpnytlslkcr
    apevsqyiyqvydsilkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e42B (B:)
    ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
    ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv
    lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
    dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn