Lineage for d1e42b2 (1e42 B:825-937)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730921Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 730922Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 730923Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 730935Protein Beta2-adaptin AP2, C-terminal subdomain [55715] (1 species)
  7. 730936Species Human (Homo sapiens) [TaxId:9606] [55716] (4 PDB entries)
  8. 730938Domain d1e42b2: 1e42 B:825-937 [40793]
    Other proteins in same PDB: d1e42a1, d1e42b1
    complexed with cl, dtt, gol, mo5, nik

Details for d1e42b2

PDB Entry: 1e42 (more details), 1.7 Å

PDB Description: beta2-adaptin appendage domain, from clathrin adaptor ap2
PDB Compounds: (B:) beta2-adaptin

SCOP Domain Sequences for d1e42b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e42b2 d.105.1.1 (B:825-937) Beta2-adaptin AP2, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn

SCOP Domain Coordinates for d1e42b2:

Click to download the PDB-style file with coordinates for d1e42b2.
(The format of our PDB-style files is described here.)

Timeline for d1e42b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e42b1