Lineage for d1e42a1 (1e42 A:705-824)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658307Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) (S)
    contains an additional N-terminal strand
  5. 658308Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
    ear domain consists of two different subdomains
  6. 658320Protein Beta2-adaptin AP2 ear domain, N-terminal subdomain [49352] (1 species)
  7. 658321Species Human (Homo sapiens) [TaxId:9606] [49353] (4 PDB entries)
  8. 658322Domain d1e42a1: 1e42 A:705-824 [22316]
    Other proteins in same PDB: d1e42a2, d1e42b2

Details for d1e42a1

PDB Entry: 1e42 (more details), 1.7 Å

PDB Description: beta2-adaptin appendage domain, from clathrin adaptor ap2
PDB Compounds: (A:) beta2-adaptin

SCOP Domain Sequences for d1e42a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e42a1 b.1.10.1 (A:705-824) Beta2-adaptin AP2 ear domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv
ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv

SCOP Domain Coordinates for d1e42a1:

Click to download the PDB-style file with coordinates for d1e42a1.
(The format of our PDB-style files is described here.)

Timeline for d1e42a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e42a2