| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Non-symbiotic plant hemoglobin [46484] (1 species) |
| Species Rice (Oryza sativa) [TaxId:4530] [46485] (3 PDB entries) |
| Domain d1d8ua_: 1d8u A: [15233] complexed with hem |
PDB Entry: 1d8u (more details), 2.35 Å
SCOPe Domain Sequences for d1d8ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8ua_ a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]}
alvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrns
dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae
Timeline for d1d8ua_: