Lineage for d1d8ua_ (1d8u A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.2: Globins [46463] (27 proteins)
Heme-binding protein
Protein Non-symbiotic plant hemoglobin [46484] (1 species) Species Rice (Oryza sativa) [TaxId:4530] [46485] (3 PDB entries) 
Domain d1d8ua_: 1d8u A: [15233]
complexed with hem
Details for d1d8ua_
PDB Entry: 1d8u (more details), 2.35 Å
PDB Description: crystal structure of non-symbiotic plant hemoglobin from rice
PDB Compounds: (A:) non-symbiotic hemoglobinSCOPe Domain Sequences for d1d8ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8ua_ a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]}
alvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrns
dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae
SCOPe Domain Coordinates for d1d8ua_:
Click to download the PDB-style file with coordinates for d1d8ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d8ua_:
- d1d8ua_ first appeared (with stable ids) in SCOP 1.55
- d1d8ua_ appears in SCOPe 2.07
View in 3D
