PDB entry 1d8u

View 1d8u on RCSB PDB site
Description: crystal structure of non-symbiotic plant hemoglobin from rice
Class: oxygen storage/transport
Keywords: globin, bis-histidyl, heme protein, oxygen storage/transport
Deposited on 1999-10-26, released 2001-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-symbiotic hemoglobin
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d8ua_
  • Chain 'B':
    Compound: non-symbiotic hemoglobin
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d8ub_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d8uA (A:)
    malvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrn
    sdvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfe
    vvkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8uA (A:)
    alvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrns
    dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
    vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d8uB (B:)
    malvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrn
    sdvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfe
    vvkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8uB (B:)
    alvednnavavsfseeqealvlkswailkkdsanialrfflkifevapsasqmfsflrns
    dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
    vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae