Lineage for d1ckla2 (1ckl A:63-126)
- Root: SCOPe 2.04
Class g: Small proteins [56992] (91 folds) 
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
disulfide-rich all-beta foldSuperfamily g.18.1: Complement control module/SCR domain [57535] (2 families) 
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
Pfam PF00084
Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57542] (2 PDB entries) 
Domain d1ckla2: 1ckl A:63-126 [44852]
N-terminal two domains
complexed with ca, cl
Details for d1ckla2
PDB Entry: 1ckl (more details), 3.1 Å
PDB Description: n-terminal two domains of human cd46 (membrane cofactor protein, mcp)
PDB Compounds: (A:) protein (cd46)SCOPe Domain Sequences for d1ckla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckla2 g.18.1.1 (A:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}
etcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkppi
cekv
SCOPe Domain Coordinates for d1ckla2:
Click to download the PDB-style file with coordinates for d1ckla2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ckla2:
- d1ckla2 first appeared (with stable ids) in SCOP 1.55
- d1ckla2 appears in SCOPe 2.03
- d1ckla2 appears in SCOPe 2.05
- d1ckla2 appears in the current release, SCOPe 2.08
View in 3D
