Lineage for d1ckla2 (1ckl A:63-126)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963726Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1963727Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 1963728Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1963748Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species)
  7. 1963749Species Human (Homo sapiens) [TaxId:9606] [57542] (2 PDB entries)
  8. 1963755Domain d1ckla2: 1ckl A:63-126 [44852]
    N-terminal two domains
    complexed with ca, cl

Details for d1ckla2

PDB Entry: 1ckl (more details), 3.1 Å

PDB Description: n-terminal two domains of human cd46 (membrane cofactor protein, mcp)
PDB Compounds: (A:) protein (cd46)

SCOPe Domain Sequences for d1ckla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckla2 g.18.1.1 (A:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}
etcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkppi
cekv

SCOPe Domain Coordinates for d1ckla2:

Click to download the PDB-style file with coordinates for d1ckla2.
(The format of our PDB-style files is described here.)

Timeline for d1ckla2: