Class g: Small proteins [56992] (91 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57542] (2 PDB entries) |
Domain d1cklc2: 1ckl C:63-126 [44856] N-terminal two domains complexed with ca, cl |
PDB Entry: 1ckl (more details), 3.1 Å
SCOPe Domain Sequences for d1cklc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cklc2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} etcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkppi cekv
Timeline for d1cklc2: