Lineage for d1cjga_ (1cjg A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
core: 4 helices; folded leaf, closedSuperfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) 
Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
lacks the first helix of canonical fold
3 helices; bundle, partly opened, right-handed twistProtein Lac repressor (LacR), N-terminal domain [47441] (1 species) Species Escherichia coli [TaxId:562] [47442] (14 PDB entries) 
Domain d1cjga_: 1cjg A: [17112]
protein/DNA complex
Details for d1cjga_
PDB Entry: 1cjg (more details)
PDB Description: nmr structure of lac repressor hp62-dna complex
PDB Compounds: (A:) protein (lac repressor)SCOPe Domain Sequences for d1cjga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjga_ a.35.1.5 (A:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
sl
SCOPe Domain Coordinates for d1cjga_:
Click to download the PDB-style file with coordinates for d1cjga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cjga_:
- d1cjga_ first appeared (with stable ids) in SCOP 1.55
- d1cjga_ appears in SCOPe 2.07
View in 3D
