Lineage for d1bx2b2 (1bx2 B:3-92)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) 
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) 
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (12 PDB entries) 
Domain d1bx2b2: 1bx2 B:3-92 [38184]
Other proteins in same PDB: d1bx2a1, d1bx2a2, d1bx2b1, d1bx2d1, d1bx2d2, d1bx2e1
Details for d1bx2b2
PDB Entry: 1bx2 (more details), 2.6 Å
PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein
PDB Compounds: (B:) protein (hla-dr2)SCOP Domain Sequences for d1bx2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx2b2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvq
SCOP Domain Coordinates for d1bx2b2:
Click to download the PDB-style file with coordinates for d1bx2b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bx2b2:
- d1bx2b2 first appeared (with stable ids) in SCOP 1.55
- d1bx2b2 appears in SCOP 1.71
- d1bx2b2 appears in SCOP 1.75
- d1bx2b2 appears in the current release, SCOPe 2.08
View in 3D
