Lineage for d1bx2a2 (1bx2 A:2-81)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719728Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 719761Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (8 PDB entries)
  8. 719770Domain d1bx2a2: 1bx2 A:2-81 [38183]
    Other proteins in same PDB: d1bx2a1, d1bx2b1, d1bx2b2, d1bx2d1, d1bx2e1, d1bx2e2

Details for d1bx2a2

PDB Entry: 1bx2 (more details), 2.6 Å

PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein
PDB Compounds: (A:) protein (hla-dr2)

SCOP Domain Sequences for d1bx2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx2a2 d.19.1.1 (A:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niavdkanleimtkrsnytp

SCOP Domain Coordinates for d1bx2a2:

Click to download the PDB-style file with coordinates for d1bx2a2.
(The format of our PDB-style files is described here.)

Timeline for d1bx2a2: