Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries) |
Domain d1bx2a2: 1bx2 A:2-81 [38183] Other proteins in same PDB: d1bx2a1, d1bx2b1, d1bx2b2, d1bx2d1, d1bx2e1, d1bx2e2 complexed with nag fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1bx2 (more details), 2.6 Å
SCOPe Domain Sequences for d1bx2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bx2a2 d.19.1.1 (A:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala niavdkanleimtkrsnytp
Timeline for d1bx2a2: