SCOP 1.55: Domain d1bx2b2: 1bx2 B:3-92

Lineage for d1bx2b2 (1bx2 B:3-92)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [54461] (3 PDB entries)

8. Domain d1bx2b2: 1bx2 B:3-92 [38184]
   Other proteins in same PDB: d1bx2a1, d1bx2b1, d1bx2d1, d1bx2e1

Details for d1bx2b2

PDB Entry: 1bx2, 2.6 Å

PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein

SCOP Domain Sequences for d1bx2b2:

Sequence; same for both SEQRES and ATOM records:

>d1bx2b2 d.19.1.1 (B:3-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvq

Timeline for d1bx2b2:

• d1bx2b2 appears in SCOP 1.57
  
• d1bx2b2 appears in the current release, SCOPe 2.08