Lineage for d1bjna_ (1bjn A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
formerly omega-Aminoacid:pyruvate aminotransferase-likeProtein Phosphoserine aminotransferase, PSAT [53426] (3 species) 
Species Escherichia coli [TaxId:562] [53428] (2 PDB entries) 
Domain d1bjna_: 1bjn A: [34469]
Details for d1bjna_
PDB Entry: 1bjn (more details), 2.3 Å
PDB Description: structure of phosphoserine aminotransferase from escherichia coli
PDB Compounds: (A:) phosphoserine aminotransferaseSCOPe Domain Sequences for d1bjna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]}
qifnfssgpamlpaevlkqaqqelrdwnglgtsvmevshrgkefiqvaeeaekdfrdlln
vpsnykvlfchgggrgqfaavplnilgdkttadyvdagywaasaikeakkyctpnvfdak
vtvdglravkpmrewqlsdnaaymhycpnetidgiaidetpdfgadvvvaadfsstilsr
pidvsrygviyagaqknigpagltivivredllgkaniacpsildysilndngsmfntpp
tfawylsglvfkwlkanggvaemdkinqqkaellygvidnsdfyrndvakrnrsrmnvpf
qladsaldklfleesfaaglhalkghrvvggmrasiynamplegvkaltdfmveferrhg
SCOPe Domain Coordinates for d1bjna_:
Click to download the PDB-style file with coordinates for d1bjna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bjna_:
- d1bjna_ first appeared (with stable ids) in SCOP 1.55
- d1bjna_ appears in SCOPe 2.05
- d1bjna_ appears in SCOPe 2.07
- d1bjna_ appears in the current release, SCOPe 2.08
View in 3D
